Name : Recombinant Mouse beta-NGF protein ,No Tag

Background :

Background :

Biological Activity :

Species :
Mus musculus (Mouse)

Expression System :

Protein Accession :
P01139

Synonyms :
Recombinant Mouse beta-NGF protein ,No Tag

Amino Acid Sequence :

Molecular Weight :
13.2kDa

Purity :
>90% as determined by SDS-PAGE

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the mouse Ngf(Ser122-Ala241) was fused without Tag

Formulation :
Supplied as solution form in PBS or lyophilized from PBS .

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
254109-22-3 Synonym 284028-89-3 Synonym PMID:29763117 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant human Mitochondrial peptide methionine sulfoxide reductase isoform a

Brief Description :
Recombinant Protein

Accession No. :
Q9UJ68

Calculated MW :
27.5 kDa

Target Sequence :
GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9UJ68

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD63 Antibody custom synthesis Tolvaptan Autophagy PMID:34898373 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human CSN1S1, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P47710

Synonyms :
Recombinant Human CSN1S1, N-His

Amino Acid Sequence :

Molecular Weight :
22.40 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human CSN1S1(Arg16-Trp185) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
204255-11-8 Formula 304896-28-4 InChIKey PMID:31424852 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Transcription factor SOX-9(SOX9)

Brief Description :
Recombinant Proteins

Accession No. :

Calculated MW :

Target Sequence :
1-509aa

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20��C/-80��C. The shelf life of lyophilized form is 12 months at -20��C/-80��C.

Application Details :
Greater than 85% as determined by SDS-PAGE.

Uniprot :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
KLF15 Antibody MedChemExpress CD141 Antibody site PMID:34697812 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human CDKN2A/p16INK4a, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P42771

Synonyms :
Recombinant Human CDKN2A/p16INK4a, N-His

Amino Acid Sequence :

Molecular Weight :
18.84 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human CDKN2A / p16INK4a(Met1-Asp156) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
162635-04-3 manufacturer 55721-31-8 site PMID:29262176 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Ubiquitin-like protein SMT3

Brief Description :
Recombinant Protein

Accession No. :
Q12306

Calculated MW :
27.1 kDa

Target Sequence :
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q12306

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Clindamycin site CD276/B7H3 Antibody Cancer PMID:34937082 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human FRK, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P42685

Synonyms :
Recombinant Human FRK, N-His

Amino Acid Sequence :

Molecular Weight :
32.18 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human FRK(Ile234-Phe491) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
163222-33-1 Molecular Weight 123318-82-1 supplier PMID:29083684 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Bovine Pregnancy-associated glycoprotein 1(PAG1)

Brief Description :
Recombinant Protein

Accession No. :
Q29432

Calculated MW :
40.7 kDa

Target Sequence :
RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGLARAV

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q29432

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
MECP2 Antibody Purity Goat Anti-Rabbit IgG H&L (AP) Epigenetics PMID:35219894 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human ADSL, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P30566

Synonyms :
Recombinant Human ADSL, N-His

Amino Acid Sequence :

Molecular Weight :
40.78 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human ADSL(Ala146-Leu484) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
59865-13-3 InChIKey 50-22-6 site PMID:30499762 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Toxoplasma gondii Dense granule protein 1

Brief Description :
Recombinant Protein

Accession No. :
P13403

Calculated MW :
21.9 kDa

Target Sequence :
AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P13403

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TSHB Antibody In Vivo 6-(4-Hydroxyphenoxy)hexyl site PMID:35237616 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com